PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G170900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 754aa    MW: 83657.6 Da    PI: 6.1487
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G170900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-2198153156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        r+k +++t+eq++e+e+lF+++++p++++r++L+kklgL  rqVk+WFqNrR++ k
  Aqcoe7G170900.1.p  98 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKKLGLAPRQVKFWFQNRRTQIK 153
                        7999************************************************9877 PP

2START222.51.4e-692704923206
                        HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
              START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                          +a++el k+a+a+ep+W +s+    e++n+de++++f+++k+      +s+ea+r++gvv+ +l++lv++++d++ qW+e+++    ka+
  Aqcoe7G170900.1.p 270 VDQAMEELTKMASAGEPLWIRSVetgrEILNYDEYIREFSSEKSgksqikRSIEASRETGVVFVDLPRLVQSFMDVN-QWKEMFPciisKAA 360
                        5789***********************************99999*********************************.************** PP

                        EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        +++vissg      ga+qlm+aelq+l+p+vp R+++f+R+++ql+ ++w+ivd+Svd  +++  +s + ++++ pSg+++e+ksngh+kv+
  Aqcoe7G170900.1.p 361 IVDVISSGdtinrnGAIQLMFAELQMLTPMVPtREVYFIRSCKQLTPDRWAIVDISVDKVEDNI-DSALTKCRKQPSGCILEDKSNGHCKVI 451
                        **************************************************************98.9************************** PP

                        EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        wveh +++++ +h ++rs+v++gla+gak+w++tlq+qce+
  Aqcoe7G170900.1.p 452 WVEHLECQKSPVHTMYRSIVNNGLAFGAKHWMSTLQHQCER 492
                        ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-2285149IPR009057Homeodomain-like
SuperFamilySSF466891.04E-2086156IPR009057Homeodomain-like
PROSITE profilePS5007118.15595155IPR001356Homeobox domain
SMARTSM003891.1E-1897159IPR001356Homeobox domain
PfamPF000461.0E-1898153IPR001356Homeobox domain
CDDcd000861.15E-16105153No hitNo description
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PROSITE profilePS5084840.482259495IPR002913START domain
SuperFamilySSF559611.65E-33262492No hitNo description
CDDcd088753.80E-108263491No hitNo description
SMARTSM002341.6E-69268492IPR002913START domain
PfamPF018521.3E-55270492IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-4313491IPR023393START-like domain
SuperFamilySSF559611.3E-13522736No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MSSNNPNSRT KDFFASPALS LSLAGVFRNA GAMASSSMEV EQGEEEINGG NGGGGGREGT  60
VDVSSENTGN GRSDEDMDDE GVQEDDGDHE DIHKKKKRKK YHRHTAEQIR EMEALFKESP  120
HPDEKQRQQL SKKLGLAPRQ VKFWFQNRRT QIKAVQERHE NSLLKSELEK IREENRAMRE  180
TVKKACCPNC GSATSNNDTT LTTEEQQLRI ENAKLKTEIE KLRAVSGKYP TKTMSPSSSC  240
SAGNDQESRS SLENYNELIG LERSRISEIV DQAMEELTKM ASAGEPLWIR SVETGREILN  300
YDEYIREFSS EKSGKSQIKR SIEASRETGV VFVDLPRLVQ SFMDVNQWKE MFPCIISKAA  360
IVDVISSGDT INRNGAIQLM FAELQMLTPM VPTREVYFIR SCKQLTPDRW AIVDISVDKV  420
EDNIDSALTK CRKQPSGCIL EDKSNGHCKV IWVEHLECQK SPVHTMYRSI VNNGLAFGAK  480
HWMSTLQHQC ERLVFFMATN VPTKDSSGVS TLAGRKSILK LAQRMTWSFC RAVGASSYNT  540
WTKLLTKGGD DLRVASRKNL NDPGEPLGMI LCAVSSVWLP VSPHTLFDFL RDETQRNEWD  600
IMSTGIPVES IANLAKGQDR GNAVAVQAMK SKENSMWILQ DSCTNSYESM VVYAPVEIAG  660
LQSVMTGCDS SNIAILPSGF SILPDGFETR PTVITTRPEE KSMDGGSLLT IAFQILANTS  720
PTAKLSAESV DTVNTLISCT LQKIKASLKC EDG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19398KKKKRK
29399KKKKRKK
39599KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249693.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLD7U0I30.0D7U0I3_VITVI; Putative uncharacterized protein
STRINGVIT_09s0002g04340.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein